PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04381.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 254aa    MW: 28640.2 Da    PI: 8.3078
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04381.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.3e-17653148
                                  TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                  +g WTt+Ed+ll++ v+q+G g W++++++ g++R +k+c++rw +yl
  Zmw_sc04381.1.g00030.1.am.mk  6 KGLWTTQEDKLLIEHVRQHGDGGWNSVSKHTGLKRNGKSCRLRWVNYL 53
                                  678*****************************9*************97 PP

2Myb_DNA-binding52.11.6e-1660103247
                                   SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   gr T +E+ ++v++++++G++ W+tIar ++ gRt++++k++w+++
  Zmw_sc04381.1.g00030.1.am.mk  60 GRITSQEERIIVQLHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 103
                                   789******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.874153IPR017930Myb domain
SMARTSM007176.3E-13555IPR001005SANT/Myb domain
SuperFamilySSF466892.28E-285100IPR009057Homeodomain-like
PfamPF002498.2E-16653IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-21760IPR009057Homeodomain-like
CDDcd001671.33E-10953No hitNo description
PROSITE profilePS5129424.02754108IPR017930Myb domain
SMARTSM007176.1E-1558106IPR001005SANT/Myb domain
PfamPF002491.3E-1360103IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.0E-2361106IPR009057Homeodomain-like
CDDcd001671.35E-1063104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MVHSLKGLWT TQEDKLLIEH VRQHGDGGWN SVSKHTGLKR NGKSCRLRWV NYLRPDLKHG  60
RITSQEERII VQLHALWGNR WSTIARSLPG RTDNEIKNYW RTHFKKAKPS KNIERARAQF  120
LKQRREMQCQ QQQQQLQLVR KNEDSKLDAT RTAGTVEDED RGSAVVDNAC PATTTAAVAD  180
QSGHHLAADL VMHDAIMDFM CPMSFSLLLH VAGGCCGSTS EEYRSSEEDG ATWGSLWNLE  240
DVFVNGGGGA CSLW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-26610627126MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978126.11e-104PREDICTED: transcription repressor MYB6-like
TrEMBLK3Y9D01e-104K3Y9D0_SETIT; Uncharacterized protein
STRINGSi010822m1e-104(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584